PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA33G00141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ZF-HD
Protein Properties Length: 246aa    MW: 28351.9 Da    PI: 9.4583
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA33G00141genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.46.1e-3248103258
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  +kv+YkeC+kNhAa+ Ggh++DGCgEfm+s geeg++++l CaAC+CHR+FHR+e +
   AA33G00141  48 QKVKYKECQKNHAATSGGHVIDGCGEFMSS-GEEGSPESLLCAACDCHRSFHRKEID 103
                  789**************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.5E-2950102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1550108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-3151102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.41752101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.3E-25167235IPR009057Homeodomain-like
SuperFamilySSF466892.75E-15168234IPR009057Homeodomain-like
TIGRFAMsTIGR015651.7E-28174231IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEEQQLEISI SKRRKSIKPT KRIESNPVTN PDPDPKSNPK PQKSPNQQKV KYKECQKNHA  60
ATSGGHVIDG CGEFMSSGEE GSPESLLCAA CDCHRSFHRK EIDGVYVVKV SNFTHQTRPV  120
ITHQASPIMM SFGGGGVAGA PAESSTEDLN KIHHCFNKGF DFNQFQENHY HSPKKRFRTK  180
FNKEQKEKMM EFAEKIKWRI NKGEDDEVNR FCSEINVKRQ VFKVWMHNHK QNQHQQQNQE  240
EKSNKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-191752301873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409164.12e-97hypothetical protein EUTSA_v10022806mg
SwissprotQ9ZPW77e-98ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JR931e-99A0A078JR93_BRANA; BnaCnng66730D protein
STRINGAT2G18350.12e-95(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.13e-79homeobox protein 24